Rss Feed
Tweeter button
Facebook button
Technorati button
Reddit button
Myspace button
Linkedin button
Webonews button
Delicious button
Digg button
Flickr button

Recent Readers

View My Profile View My Profile View My Profile View My Profile View My Profile

Free Tell A Friend
Tell a Friend

Girls Crosses Clipart Collection

Brand new clipart collection that is perfect for Easter, communion, Sunday school and more!

http://primsydoodledesigns.net/index.php?main_page=product_info&products_id=1217

Boys Crosses Clipart collection

Brand new clipart collection that is perfect for Easter, communion, Sunday school and more!

http://primsydoodledesigns.net/index.php?main_page=product_info&products_id=1216

New Mice Clipart Just Released



www.primsydoodledesigns.net

Frogs + Butterfly Girls Clipart

Stolen domain

Most of you know by now that my two domains; Primsy Doodle designs and Primsy Resale were stolen by someone who most likely had a key logger. Luckily, I caught it fast enough to get my domains back. It wasn’t easy though as GoDaddy gave me a very hard time! It is very hard to prove you own the domains, but it was simple for the hacker to steal them…..

It has been hard to get everything back the way it was, but we are almost there.

Brand new year-Brand new clipart

previewtemplay2valentinegirls10

previewtemplay-valentinebears10

previewtemplay-valentineangels10

previewtemplay-springbears10

www.primsydoodledesigns.net

Christmas Clipart

www.primsydoodledesigns.net

Cute Winter/Christmas Clipart!

New Printable Ornie Tags

These are adorably whimsical hang tags that you can print out as many times as you want! Created at 300 dpi!

2 new collections, 1 new mini collection

www.primsydoodledesigns.net


Related Posts with Thumbnails
Get Adobe Flash playerPlugin by wpburn.com wordpress themes